PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 287aa    MW: 32329.8 Da    PI: 8.559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015230.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed+ l ++++ +G g W+  +++ g++R++k+c++rw++yl
      Pbr015230.1 15 RGAWTAMEDKVLTEYIRNHGEGKWRNLPKRAGLRRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding51.81.9e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E+el+++++k+lG++ W++Ia +++ gRt++++k++w++
      Pbr015230.1  68 RGNITRDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 111
                      7899******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4611062IPR017930Myb domain
SuperFamilySSF466891.91E-2713109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002491.3E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-221669IPR009057Homeodomain-like
CDDcd001679.14E-91762No hitNo description
PROSITE profilePS5129425.15263117IPR017930Myb domain
SMARTSM007172.8E-1567115IPR001005SANT/Myb domain
PfamPF002492.7E-1468111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2470116IPR009057Homeodomain-like
CDDcd001672.45E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRSPCCSKD EGLNRGAWTA MEDKVLTEYI RNHGEGKWRN LPKRAGLRRC GKSCRLRWLN  60
YLRPDIKRGN ITRDEEELII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TTIGKRIQVE  120
GRLCSDGNRR PTQEKPKPTL SPKPCTNISC TKVVRTKASR CTKVVLPHES QKFGHSTKQV  180
VNAAPILDQA MNNPMVGIDE PLLPMSFLDD ENNNSCEFLV DFKMDENFLS DFLNVDFSVL  240
YNNEGAGKAA AAATTEDTSN KLHGPDLRSS MAPIIESELD CWLVDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744630.0DQ074463.1 Malus x domestica MYB11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009372342.10.0PREDICTED: transcription factor TT2-like
TrEMBLQ2LME90.0Q2LME9_MALDO; MYB11
STRINGVIT_09s0002g01400.t011e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-61MYB family protein